Protein Info for TX73_014850 in Rhodopseudomonas palustris CGA009

Annotation: pyruvate dehydrogenase complex E1 component subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00364: Biotin_lipoyl
  • amino acids 4 to 77 (74 residues), 71.9 bits, E=4.8e-24
• PF02779: Transket_pyr
  • amino acids 147 to 321 (175 residues), 160.3 bits, E=5.8e-51
• PF02780: Transketolase_C
  • amino acids 337 to 459 (123 residues), 151.2 bits, E=2e-48

Best Hits

Swiss-Prot: 71% identical to ODPB_RHIME: Pyruvate dehydrogenase E1 component subunit beta (pdhB) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00162, pyruvate dehydrogenase E1 component subunit beta [EC: 1.2.4.1] (inferred from 100% identity to rpa:RPA2866)

Predicted SEED Role

"Pyruvate dehydrogenase E1 component beta subunit (EC 1.2.4.1)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 1.2.4.1)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
• superpathway of glyoxylate bypass and TCA (12/12 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
• TCA cycle I (prokaryotic) (10/10 steps found)
• TCA cycle III (animals) (9/10 steps found)
• TCA cycle VIII (Chlamydia) (6/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (21/27 steps found)
• TCA cycle II (plants and fungi) (8/9 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• pyruvate fermentation to acetate II (3/3 steps found)
• pyruvate fermentation to acetate V (3/3 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (8/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (3/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Butanoate metabolism
• Citrate cycle (TCA cycle)
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.2.4.1

Use Curated BLAST to search for 1.2.4.1

Protein Sequence (469 amino acids)

>TX73_014850 pyruvate dehydrogenase complex E1 component subunit beta (Rhodopseudomonas palustris CGA009)
MPIQVLMPALSPTMEKGNLSKWLKKEGDKVKSGDVIAEIETDKATMEVEAADEGTLGKIL
IPEGTNDVAVNTPIATILGDGESAADADKASDPAAQSKASQSAPPSAEPEAAQAKSAPAP
AQHAPEAPTVSAAADPDIPAGTEMVTVTIREALRDAMAEEMRRDPDVFVMGEEVAEYQGA
YKVTQGLLQEFGDRRVIDTPITEHGFAGVGVGAGFAGLKPIVEFMTFNFAMQAIDQIINS
AAKTLYMSGGQLGCSIVFRGPNGAASRVAAQHSQDYSAWYAQIPGLKVVAPYSAADAKGL
LKAAIRDPNPVIFLEHEMLYGQHGEVPKLDDYVIPIGKARIVREGKDVTLISWSHGMTYA
LKAADELAKDGIAAEVIDLRTLRPLDTDTIIASVKKTGRAVTIEEGWQQNGVGAELSARI
MEHAFDYLDAPVTRVSGKDVPMPYAANLEKLALPSVAEVVEAAKAVCYR