Protein Info for TX73_014745 in Rhodopseudomonas palustris CGA009
Annotation: twin-arginine translocase subunit TatC
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 35% identical to TATC_DESAH: Sec-independent protein translocase protein TatC (tatC) from Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2)
KEGG orthology group: K03118, sec-independent protein translocase protein TatC (inferred from 100% identity to rpa:RPA2847)Predicted SEED Role
"Twin-arginine translocation protein TatC" in subsystem Cluster-based Subsystem Grouping Hypotheticals - perhaps Proteosome Related or Twin-arginine translocation system
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (271 amino acids)
>TX73_014745 twin-arginine translocase subunit TatC (Rhodopseudomonas palustris CGA009) MSAEDIEASKAPLMDHLIELRSRLIKALLGFGIAFIFCFFFAKQIYNVLVWPFVWVAGPE NSKFIYTALLEYFLTQLKLAMFGAGFISFPIIATQIYKFVAPGLYKHERNAFVPYLIATP GFFLLGSLVVYFLVLPMLVRFSLGMQQMGGAETAQIQLLPKVGEYLSLMMSLIFAFGLAF QLPVILTLLGRIGVLTAKQLKEKRRYFIVGAFIIAAVLTPPDVISQASLAIPLLLLYEGS IIAVSMVEKKRAAADASASANASTDSSTPAA