Protein Info for TX73_014745 in Rhodopseudomonas palustris CGA009

Annotation: twin-arginine translocase subunit TatC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 transmembrane" amino acids 24 to 46 (23 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 112 to 135 (24 residues), see Phobius details amino acids 168 to 194 (27 residues), see Phobius details amino acids 206 to 223 (18 residues), see Phobius details amino acids 229 to 247 (19 residues), see Phobius details TIGR00945: twin arginine-targeting protein translocase TatC" amino acids 13 to 237 (225 residues), 198.7 bits, see alignment E=5.9e-63 PF00902: TatC" amino acids 15 to 232 (218 residues), 231.2 bits, see alignment E=5.7e-73

Best Hits

Swiss-Prot: 35% identical to TATC_DESAH: Sec-independent protein translocase protein TatC (tatC) from Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2)

KEGG orthology group: K03118, sec-independent protein translocase protein TatC (inferred from 100% identity to rpa:RPA2847)

Predicted SEED Role

"Twin-arginine translocation protein TatC" in subsystem Cluster-based Subsystem Grouping Hypotheticals - perhaps Proteosome Related or Twin-arginine translocation system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (271 amino acids)

>TX73_014745 twin-arginine translocase subunit TatC (Rhodopseudomonas palustris CGA009)
MSAEDIEASKAPLMDHLIELRSRLIKALLGFGIAFIFCFFFAKQIYNVLVWPFVWVAGPE
NSKFIYTALLEYFLTQLKLAMFGAGFISFPIIATQIYKFVAPGLYKHERNAFVPYLIATP
GFFLLGSLVVYFLVLPMLVRFSLGMQQMGGAETAQIQLLPKVGEYLSLMMSLIFAFGLAF
QLPVILTLLGRIGVLTAKQLKEKRRYFIVGAFIIAAVLTPPDVISQASLAIPLLLLYEGS
IIAVSMVEKKRAAADASASANASTDSSTPAA