Protein Info for TX73_014695 in Rhodopseudomonas palustris CGA009

Annotation: protein-L-isoaspartate(D-aspartate) O-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 PF01135: PCMT" amino acids 17 to 210 (194 residues), 178.7 bits, see alignment E=3.4e-56 TIGR00080: protein-L-isoaspartate O-methyltransferase" amino acids 18 to 211 (194 residues), 181.5 bits, see alignment E=1e-57 PF00398: RrnaAD" amino acids 66 to 157 (92 residues), 27.9 bits, see alignment E=3.1e-10 PF13847: Methyltransf_31" amino acids 81 to 156 (76 residues), 28.5 bits, see alignment E=3e-10 PF13649: Methyltransf_25" amino acids 84 to 159 (76 residues), 37 bits, see alignment E=1.1e-12 PF08241: Methyltransf_11" amino acids 85 to 159 (75 residues), 29.6 bits, see alignment E=2.2e-10

Best Hits

Swiss-Prot: 75% identical to PIMT_RHOPS: Protein-L-isoaspartate O-methyltransferase (pcm) from Rhodopseudomonas palustris (strain BisB5)

KEGG orthology group: K00573, protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC: 2.1.1.77] (inferred from 100% identity to rpa:RPA2838)

MetaCyc: 52% identical to protein-L-isoaspartate O-methyltransferase (Escherichia coli K-12 substr. MG1655)
Protein-L-isoaspartate(D-aspartate) O-methyltransferase. [EC: 2.1.1.77]

Predicted SEED Role

"Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77)" in subsystem Ton and Tol transport systems (EC 2.1.1.77)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.77

Use Curated BLAST to search for 2.1.1.77

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (217 amino acids)

>TX73_014695 protein-L-isoaspartate(D-aspartate) O-methyltransferase (Rhodopseudomonas palustris CGA009)
MPSPAAPPPEKMMFQLSLRRRGISDQAVLRTMEAVPRDQFVDPGYRDGAWRDTALPIACG
QTISQPFVVAFMTEQLELRPRDRVLEIGTGSGYHAAVLSRLAADVLSFERFKTLADRARK
RLAELGCRNVEVVFGDGFDLPETAGTFDRILITAAVPELPARLLERLDPGGVLIAPVGPP
NGRQTLLRVRRTPNGDEHKALGEVRFVPALRGIAREL