Protein Info for TX73_014655 in Rhodopseudomonas palustris CGA009

Annotation: protein translocase subunit SecF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 217 to 238 (22 residues), see Phobius details amino acids 267 to 288 (22 residues), see Phobius details amino acids 294 to 318 (25 residues), see Phobius details PF07549: Sec_GG" amino acids 60 to 83 (24 residues), 35.8 bits, see alignment (E = 4.1e-13) TIGR00966: protein-export membrane protein SecF" amino acids 65 to 311 (247 residues), 259.8 bits, see alignment E=3e-81 TIGR00916: protein-export membrane protein, SecD/SecF family" amino acids 119 to 308 (190 residues), 181.7 bits, see alignment E=1.7e-57 PF02355: SecD_SecF" amino acids 135 to 319 (185 residues), 217.9 bits, see alignment E=8.2e-69

Best Hits

KEGG orthology group: K03074, preprotein translocase subunit SecF (inferred from 100% identity to rpa:RPA2830)

MetaCyc: 37% identical to Sec translocon accessory complex subunit SecF (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Protein-export membrane protein SecF (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (372 amino acids)

>TX73_014655 protein translocase subunit SecF (Rhodopseudomonas palustris CGA009)
MTHWILVGLGVLIVVLTVVSIFGWLPSLRIVPDNTHFDFTRFRRISFPISAVLSIAAITL
FFTHGLNFGIDFRGGTLLEVRAHSGAADIAGMRDTLSKLSLGDVQLQQFGGPAEVLIRIA
EQPGGDQAQQVAVQKVRAALGDSVDYRRVEVVGPRVSSELLAFGMLGLMVAILGILVYLW
FRFEWQFALGAMIANVHDIVLTIGFMSISQVDFDLTSIAALLTILGYSLNDTVVIYDRIR
EMLRRYKKMPMPQLLNESINSTLSRSIITHVTVTLALLALLLFGGHAIHSFTAVMMFGVV
LVGTYTSIFIAAPILIYLGVGTHRLDEPAEKPAKPEPVTPPAAAEEIPAQFVEPEPAAPA
SKPAKAGKPKKR