Protein Info for TX73_014530 in Rhodopseudomonas palustris CGA009

Annotation: nitrile hydratase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03888: nitrile hydratase, beta subunit
  • amino acids 1 to 218 (218 residues), 261.2 bits, E=4.9e-82
• PF21006: NHase_beta_N
  • amino acids 1 to 101 (101 residues), 133.7 bits, E=3.2e-43
• PF02211: NHase_beta_C
  • amino acids 120 to 216 (97 residues), 135 bits, E=1.1e-43

Best Hits

KEGG orthology group: K01721, nitrile hydratase [EC: 4.2.1.84] (inferred from 100% identity to rpa:RPA2806)

Predicted SEED Role

"Cobalt-containing nitrile hydratase subunit beta (EC 4.2.1.84)" (EC 4.2.1.84)

MetaCyc Pathways

• superpathway of acrylonitrile degradation (3/3 steps found)
• acrylonitrile degradation I (2/2 steps found)
• indole-3-acetate biosynthesis IV (bacteria) (2/2 steps found)
• aldoxime degradation (1/3 steps found)
• indole-3-acetate biosynthesis II (5/12 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Benzoate degradation via CoA ligation
• Cyanoamino acid metabolism
• Styrene degradation
• Tryptophan metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.84

Use Curated BLAST to search for 4.2.1.84

Protein Sequence (218 amino acids)

>TX73_014530 nitrile hydratase subunit beta (Rhodopseudomonas palustris CGA009)
MNGAHDMGGMDGFGPIVIEPHEPLFHAAWERRAFALTLAMGRPGGWNIDMSRFARENRAP
IDYLSKSYYQLWLAGLEVLMAERGLVTADEIAAGRPLHPRRDVQVLTAADVTPMLARGAP
TERDAAAPARFGVGDHVRAKDLHPRTHIRLPRYVRGRIGTIELVHGAHVFPDSHAHGGGE
QPQWLYTVAFEARELWGDDADPTSRVSVDAWDSYLERA