Protein Info for TX73_014525 in Rhodopseudomonas palustris CGA009

Annotation: nitrile hydratase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02979: NHase_alpha
  • amino acids 21 to 202 (182 residues), 307.2 bits, E=1.5e-96
• TIGR01323: nitrile hydratase, alpha subunit
  • amino acids 21 to 208 (188 residues), 323.2 bits, E=4.4e-101

Best Hits

Swiss-Prot: 67% identical to NHAA_PSEPU: Nitrile hydratase subunit alpha (nthA) from Pseudomonas putida

KEGG orthology group: K01721, nitrile hydratase [EC: 4.2.1.84] (inferred from 100% identity to rpa:RPA2805)

MetaCyc: 57% identical to nitrile hydratase alpha subunit (Rhodococcus rhodochrous)
Nitrile hydratase. [EC: 4.2.1.84]

Predicted SEED Role

"Cobalt-containing nitrile hydratase subunit alpha (EC 4.2.1.84)" (EC 4.2.1.84)

MetaCyc Pathways

• superpathway of acrylonitrile degradation (3/3 steps found)
• acrylonitrile degradation I (2/2 steps found)
• indole-3-acetate biosynthesis IV (bacteria) (2/2 steps found)
• aldoxime degradation (1/3 steps found)
• indole-3-acetate biosynthesis II (5/12 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Benzoate degradation via CoA ligation
• Cyanoamino acid metabolism
• Styrene degradation
• Tryptophan metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.84

Use Curated BLAST to search for 4.2.1.84

Protein Sequence (213 amino acids)

>TX73_014525 nitrile hydratase subunit alpha (Rhodopseudomonas palustris CGA009)
MADHEHHHHHHHDHDHSELSETELRVRALETILTEKGYVDPAALDELIETYETKVGPRNG
AQVVAKAWSDPAYRERLLHDATAAIAELGYTGRQGEHIVAVENTPATHNMVVCTLCSCYP
WPVLGLPPVWYKSAPYRSRVVKEPRAVLAEFGVTLPQDTAIRVWDSTAEIRYLVLPMRPE
GSDDFSEGQLADLVTRDSMIGTGLARTPAEIPA