Protein Info for TX73_014480 in Rhodopseudomonas palustris CGA009

Annotation: serine hydroxymethyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00464: SHMT
  • amino acids 24 to 399 (376 residues), 535 bits, E=1.4e-164
• PF00155: Aminotran_1_2
  • amino acids 99 to 383 (285 residues), 25.3 bits, E=1.3e-09

Best Hits

Swiss-Prot: 100% identical to GLYA2_RHOPA: Serine hydroxymethyltransferase 2 (glyA2) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K00600, glycine hydroxymethyltransferase [EC: 2.1.2.1] (inferred from 100% identity to rpa:RPA2796)

MetaCyc: 66% identical to serine hydroxymethyltransferase subunit (Hyphomicrobium methylovorum GM2)
Glycine hydroxymethyltransferase. [EC: 2.1.2.1]

Predicted SEED Role

"Serine hydroxymethyltransferase (EC 2.1.2.1)" in subsystem Folate Biosynthesis or Glycine Biosynthesis or Glycine and Serine Utilization or LMPTP YwlE cluster or Photorespiration (oxidative C2 cycle) or Serine-glyoxylate cycle or Serine Biosynthesis (EC 2.1.2.1)

MetaCyc Pathways

• folate transformations III (E. coli) (8/9 steps found)
• photorespiration I (8/9 steps found)
• photorespiration III (8/9 steps found)
• superpathway of L-serine and glycine biosynthesis I (4/4 steps found)
• dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
• photorespiration II (8/10 steps found)
• folate polyglutamylation (4/5 steps found)
• glycine biosynthesis I (1/1 steps found)
• folate transformations II (plants) (8/11 steps found)
• glycine degradation (2/3 steps found)
• folate transformations I (8/13 steps found)
• formaldehyde assimilation I (serine pathway) (8/13 steps found)
• glycine betaine degradation II (mammalian) (1/4 steps found)
• glycine betaine degradation III (3/7 steps found)
• purine nucleobases degradation II (anaerobic) (15/24 steps found)
• glycine betaine degradation I (3/8 steps found)

KEGG Metabolic Maps

• Cyanoamino acid metabolism
• Glycine, serine and threonine metabolism
• Methane metabolism
• One carbon pool by folate

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.1

Use Curated BLAST to search for 2.1.2.1

Protein Sequence (434 amino acids)

>TX73_014480 serine hydroxymethyltransferase (Rhodopseudomonas palustris CGA009)
MGPSVAPHAVHTIANPGVSAAGLVAADHAVAAAIADEETRQRDSIELIASENFVSRAVLD
AQGSVLTNKYAEGYPHRRYYGGCANVDAIEDLVIARVNQLFGSAYANVQPHSGSQANQAV
FLALLAPGDTILGLDLKAGGHLTHGAPVNMSGRWFKAVSYGVDPETHRIDMDQVAVQARQ
HRPRLLIAGGSAYPRIIDFGRFRQIADEVGAILMVDMAHFAGLVAGGVYPSPVPFADVVT
STTHKTLRGPRGGFVLTNDANIAKKINSATFPGLQGGPLMHVIAAKAVAFGEALQPEFGA
YAQAVVENCRVLAQALADGGLTITSGGTDCHLAVVDLRPFGVTGNIAEQALESVGITLNK
NAIPNDPEKPMVTSGIRVGTAAGTSRGFGADQYREIAGLVLETLHAVRAGTLDAAGQEIN
KSVRRLAASFPLPY