Protein Info for TX73_014440 in Rhodopseudomonas palustris CGA009

Annotation: class I SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 PF02353: CMAS" amino acids 58 to 124 (67 residues), 28.6 bits, see alignment E=2.2e-10 PF01135: PCMT" amino acids 61 to 173 (113 residues), 27.1 bits, see alignment E=8.6e-10 PF13847: Methyltransf_31" amino acids 70 to 195 (126 residues), 40 bits, see alignment E=8.3e-14 PF13649: Methyltransf_25" amino acids 75 to 169 (95 residues), 38.7 bits, see alignment E=3.4e-13 PF08241: Methyltransf_11" amino acids 76 to 173 (98 residues), 34.1 bits, see alignment E=9.2e-12

Best Hits

Swiss-Prot: 73% identical to YJHP_ECOLI: Uncharacterized protein YjhP (yjhP) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to rpt:Rpal_3127)

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.64

Use Curated BLAST to search for 2.1.1.64

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (283 amino acids)

>TX73_014440 class I SAM-dependent methyltransferase (Rhodopseudomonas palustris CGA009)
MTRTRGSLHTEAWCRDADSGDGASVSDRTTKGASGVDIPRIFNISESAHRIHNPFTAEKL
AMLGASLRMEPGTRVLDLGSGSGEMLCTWARDYGITGTGIDMSRLFSEQAKLRARELGVA
DRVTFVHGDAAGYVADETVGVAACVGATWIGGGVSGTIELLARSLRDGGIILIGEPYWLQ
LPPTEEVAQGCRARAISDFLLLPDLVASFGALNYDVVEMVLASQDSWDRYEAAKWLTMRR
WLDANPDDDFAADVRAELTSSPERYARYGRDYLGWGVFALMAR