Protein Info for TX73_014405 in Rhodopseudomonas palustris CGA009

Annotation: TRAP transporter large permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 627 transmembrane" amino acids 29 to 55 (27 residues), see Phobius details amino acids 70 to 87 (18 residues), see Phobius details amino acids 108 to 130 (23 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 178 to 196 (19 residues), see Phobius details amino acids 208 to 227 (20 residues), see Phobius details amino acids 233 to 251 (19 residues), see Phobius details amino acids 257 to 276 (20 residues), see Phobius details amino acids 285 to 311 (27 residues), see Phobius details amino acids 373 to 397 (25 residues), see Phobius details amino acids 418 to 436 (19 residues), see Phobius details amino acids 442 to 462 (21 residues), see Phobius details amino acids 474 to 497 (24 residues), see Phobius details amino acids 518 to 552 (35 residues), see Phobius details amino acids 562 to 587 (26 residues), see Phobius details amino acids 602 to 624 (23 residues), see Phobius details PF04290: DctQ" amino acids 47 to 172 (126 residues), 102.7 bits, see alignment E=1.5e-33 PF06808: DctM" amino acids 214 to 622 (409 residues), 335.5 bits, see alignment E=4.5e-104 TIGR00786: TRAP transporter, DctM subunit" amino acids 223 to 624 (402 residues), 278.4 bits, see alignment E=4.4e-87

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA2781)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (627 amino acids)

>TX73_014405 TRAP transporter large permease subunit (Rhodopseudomonas palustris CGA009)
MASADASQLTAGERLHAPQRKTLIGALEAALGLMVEIPAAILVVVEIVVLFAGVVSRYVF
HSPLIWSDELASILFLWLAMFGAAVAFRRGEHMRMTAMVAGASPRLRAWLDLVGICAALA
FLLLIAAPAYEYAYEESYITTPALSLANSWRAAALPVGIALMALFAALRLIRFGDLKLVV
GAALTVALLIGAFWLAQPLFKPLGNLNLVIFFVGVVACCVFAGVPIAFGFGLAIYGYLAL
TTTTPLLILVGRMDEGMSHLILLSVPLFVFLGLLIEMTGMARAMVAFLASLLGHVRGGLH
YVLVGAMYLVSGISGSKAADMAAVAPVLFPEMKERGAKPGDLVALLSATGAQTETIPPSL
VLITIGSVTGVSISALFTGGLLPGVVLAIMLSALVWWRYRGEDLSHVKRARGSEIGKAFI
VALPALALPFVIRAAVVEGVATATEVSTIGIVYAVVVGILVYRKFDLRRLRPMLVETAAL
SGAILLIIGTATGMAWGLTQSGFSRALAAAMTGLPGGSATFLAVSIVAFVILGSVLEGIP
AIVLFGPLLFPIARAVGIHEVHYAMVVILAMGIGLFAPPFGVGYYAACAIGRVDPAEGMR
PIWGYMLALLIGLIVVAAIPWISIGFL