Protein Info for TX73_014375 in Rhodopseudomonas palustris CGA009

Annotation: dTMP kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00041: dTMP kinase
  • amino acids 12 to 211 (200 residues), 165.3 bits, E=6.9e-53
• PF02223: Thymidylate_kin
  • amino acids 18 to 211 (194 residues), 154.2 bits, E=3.3e-49

Best Hits

Swiss-Prot: 100% identical to KTHY_RHOPA: Thymidylate kinase (tmk) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K00943, dTMP kinase [EC: 2.7.4.9] (inferred from 100% identity to rpt:Rpal_3114)

Predicted SEED Role

"Thymidylate kinase (EC 2.7.4.9)" (EC 2.7.4.9)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
• pyrimidine deoxyribonucleotide phosphorylation (4/4 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (6/8 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (5/7 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (6/9 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.9

Protein Sequence (230 amino acids)

>TX73_014375 dTMP kinase (Rhodopseudomonas palustris CGA009)
MVQKKPINRSLRGRFITFEGGEGAGKSTQIRLLAKRLEKARLRTLVTREPGGSPGAEAIR
SALLAGIGKLIGGADAEALLFAAARDDHVRTLIEPALARGEWVLCDRFYDSTRAYQGKLG
AVSLDLLNALQQVTIGDMKPDLTVILDIPVEIGLARAAVRRGSETPDRFESEAIDFHRGL
REVFRQIAAQEPERCVLIDANAEPEEVADRIWQAVRLRLLEPARAGAKSA