Protein Info for TX73_014365 in Rhodopseudomonas palustris CGA009

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 PF00561: Abhydrolase_1" amino acids 24 to 301 (278 residues), 122.9 bits, see alignment E=2.8e-39 PF12146: Hydrolase_4" amino acids 25 to 121 (97 residues), 47.6 bits, see alignment E=2.1e-16 PF12697: Abhydrolase_6" amino acids 26 to 307 (282 residues), 72.6 bits, see alignment E=1.2e-23

Best Hits

Swiss-Prot: 46% identical to EPHA_MYCTU: Epoxide hydrolase A (ephA) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to rpa:RPA2773)

Predicted SEED Role

"Epoxide hydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>TX73_014365 alpha/beta hydrolase (Rhodopseudomonas palustris CGA009)
MASTRSTITANGIELFLREQGEGPLVVLCHGWPELSYSWRHQIGALADAGYHVVAPDMRG
FGRSSAPQAVEAYSIFDLVGDMVALVAELGETRAAIIGHDWGAPVAWHAAQFRPDLFAAV
AGLSVPPPWRGKGPPLDQLRAAGITNFYWQYFQKLGVAETEFERDVASTMRGMLCGGFAD
PGRSLFVPEGRGFIGRSAASLPLPPWLTEAELAFFIEQYKQSGFRGGLNWYRNIDRNWEL
TSPWQGAPIHQPAAFIAGSNDPVISDKMSGKHLAAINRVLPNLKQKLIIDGAGHWIQQEK
PAEVNAALIEFLKENY