Protein Info for TX73_014355 in Rhodopseudomonas palustris CGA009

Annotation: AI-2E family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 42 to 60 (19 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 171 to 194 (24 residues), see Phobius details amino acids 230 to 253 (24 residues), see Phobius details amino acids 264 to 285 (22 residues), see Phobius details amino acids 290 to 312 (23 residues), see Phobius details amino acids 327 to 352 (26 residues), see Phobius details PF01594: AI-2E_transport" amino acids 28 to 360 (333 residues), 141.2 bits, see alignment E=2.2e-45

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpt:Rpal_3110)

Predicted SEED Role

"FIG01006288: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (383 amino acids)

>TX73_014355 AI-2E family transporter (Rhodopseudomonas palustris CGA009)
MTATLPDRAPSRTDLAWAIALGGIATVSFAALLYAAWQFAGTLFLIFAGVLFGVFLNALT
ELTGKLVGGPHGLRLALICLVLTGLTIGVAFLGGNTISQQAKALSGTIKTQIVNVKALLE
RNGVDTGFLELNPTPSAAHPETTTPVQPRNLPSAGEIASGGGAIVSQTLKLILGTIGAVG
NFFIVMFLGLAFAAQPSVYRNGLVRMVPRRYRAQADVIVTDTGEMLKRWLLAQLITMMAV
FAVTATGLSLIGIPGAFILGIQAGLLAFIPTVGAILGGLIIVLAAIGSGWIAVVSAFVLF
LGVHALESYILTPLIQRQAIDIPPATLFAMQILLGIVFGLWGLALALPLMAIGRVVLDHL
RGEEPAELISPAGTAPLAITPET