Protein Info for TX73_014290 in Rhodopseudomonas palustris CGA009

Annotation: COX15/CtaA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 transmembrane" amino acids 17 to 36 (20 residues), see Phobius details amino acids 100 to 118 (19 residues), see Phobius details amino acids 130 to 148 (19 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 200 to 220 (21 residues), see Phobius details amino acids 266 to 283 (18 residues), see Phobius details amino acids 295 to 314 (20 residues), see Phobius details amino acids 320 to 337 (18 residues), see Phobius details PF02628: COX15-CtaA" amino acids 16 to 334 (319 residues), 363.1 bits, see alignment E=6.2e-113

Best Hits

Swiss-Prot: 100% identical to CTAA_RHOPA: Heme A synthase (ctaA) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K02259, cytochrome c oxidase subunit XV assembly protein (inferred from 100% identity to rpa:RPA2758)

Predicted SEED Role

"Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (368 amino acids)

>TX73_014290 COX15/CtaA family protein (Rhodopseudomonas palustris CGA009)
MTIAAAPPSSRFRAVRIWLTLVAALIAVMVLVGGATRLTESGLSIVEWKPVTGSLPPLTD
TQWHAAFDGYKQIPQYRELNAGMTLDQFKTIFWWEWSHRLLGRVIGIVYLLPFLWFLWRG
AIGPEWKRALWIIFALGALQGAVGWWMVASGLSQRTEVSQVRLATHLSLALIIYAAIVWT
LRRMADGARVAAPVRLRVTALALLGLTFVQLYAGALVAGLRAGRLYNTWPEIDGALIPDA
ARLWFESPWWKNLFDNHLTVQFDHRMLAYALWTLAALHMIDALRTRAAARGAVQLFLALT
AQATLGIFTVLYAAPIDLALVHQAMALVVLTLAVLQAERLTATRKDRTARDRGAAGRLAI
PSEPFPSA