Protein Info for TX73_014150 in Rhodopseudomonas palustris CGA009

Annotation: sodium-translocating pyrophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 706 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 54 to 98 (45 residues), see Phobius details amino acids 121 to 147 (27 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 262 to 285 (24 residues), see Phobius details amino acids 295 to 319 (25 residues), see Phobius details amino acids 328 to 351 (24 residues), see Phobius details amino acids 386 to 428 (43 residues), see Phobius details amino acids 471 to 489 (19 residues), see Phobius details amino acids 513 to 539 (27 residues), see Phobius details amino acids 584 to 607 (24 residues), see Phobius details amino acids 615 to 639 (25 residues), see Phobius details amino acids 686 to 705 (20 residues), see Phobius details TIGR01104: V-type H(+)-translocating pyrophosphatase" amino acids 5 to 706 (702 residues), 888.2 bits, see alignment E=2.5e-271 PF03030: H_PPase" amino acids 13 to 700 (688 residues), 875.4 bits, see alignment E=1.5e-267

Best Hits

Swiss-Prot: 100% identical to HPPA_RHOPA: K(+)-insensitive pyrophosphate-energized proton pump (hppA) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K01507, inorganic pyrophosphatase [EC: 3.6.1.1] (inferred from 100% identity to rpa:RPA2731)

Predicted SEED Role

"Pyrophosphate-energized proton pump (EC 3.6.1.1)" in subsystem Phosphate metabolism (EC 3.6.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.1

Use Curated BLAST to search for 3.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (706 amino acids)

>TX73_014150 sodium-translocating pyrophosphatase (Rhodopseudomonas palustris CGA009)
MTALWVIVLCGALSIVYAIWATSSVLAADQGNARMQEIAGAVREGAQAYLKRQYMTIAIV
GVVIFALLAYFLGILVAIGFAIGAILSGAAGFIGMNVSVRANVRTAQAATTSLAGGLELA
FKAGAITGLLVAGLALLGVTLYFIYLIHFAGLQANSRTVVDALVALGFGASLISIFARLG
GGIFTKGADVGGDLVGKVEAGIPEDDPRNPATIADNVGDNVGDCAGMAADLFETYAVTAV
ATMVLAAIFFGSATPDQLQSVMTLPLAIGGICILTSIAGTFFVKLGASQSIMGALYKGLI
ATGVLSLVGVGVVIHQLIGFGPLPGVSYTGLALFECGIVGLAVTGLIIWITEYYTGTDFR
PVKSIAQASVTGHGTNVIQGLAISMESTALPAIVIIAGILITYSLAGLFGIAIATTTMLA
LAGMIVALDAFGPVTDNAGGIAEMAGLPKEVRKSTDALDAVGNTTKAVTKGYAIGSAGLG
ALVLFAAYNEDLKFFIAQKSPYFVGVAPDFSLNNPYVVVGLLFGGLLPYLFGAMGMTAVG
RAAGAIVEEVRRQFREKPGIMKGTDKPDYGKAVDLLTKAAIKEMIIPSLLPVLSPIFVYF
AIYAIAGGGAAGKSAAFSAVGAMLLGVIVTGLFVAISMTSGGGAWDNAKKYIEDGHHGGK
GSDAHKAAVTGDTVGDPYKDTAGPAVNPMIKITNIVALLLLAILAH