Protein Info for TX73_013925 in Rhodopseudomonas palustris CGA009

Annotation: large conductance mechanosensitive channel protein MscL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 transmembrane" amino acids 30 to 52 (23 residues), see Phobius details amino acids 54 to 60 (7 residues), see Phobius details amino acids 94 to 117 (24 residues), see Phobius details PF01741: MscL" amino acids 17 to 152 (136 residues), 153 bits, see alignment E=2.4e-49 TIGR00220: large conductance mechanosensitive channel protein" amino acids 17 to 153 (137 residues), 133.5 bits, see alignment E=2.5e-43

Best Hits

Swiss-Prot: 100% identical to MSCL_RHOPA: Large-conductance mechanosensitive channel (mscL) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K03282, large conductance mechanosensitive channel (inferred from 100% identity to rpa:RPA2687)

Predicted SEED Role

"Large-conductance mechanosensitive channel" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (159 amino acids)

>TX73_013925 large conductance mechanosensitive channel protein MscL (Rhodopseudomonas palustris CGA009)
MNSTDSVRHFEQKGSKLLKEFRDFAMKGNVVDLAVGVIIGAAFGGIVTSLVGDVIMPIIS
AITGGLDFSNYFTALSKSVTANTLAEAKKQGAVLAWGNFLTVTLNFLIIAAVLFAVIRSL
NKLKQQAEETKSPPPTPTRQEELLTEIRDLLKKGAGPSP