Protein Info for TX73_013795 in Rhodopseudomonas palustris CGA009

Annotation: ATP-dependent DNA helicase RecG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF17191: RecG_wedge" amino acids 17 to 179 (163 residues), 35.5 bits, see alignment E=2.2e-12 PF04851: ResIII" amino acids 271 to 429 (159 residues), 35.8 bits, see alignment E=2.3e-12 PF00270: DEAD" amino acids 275 to 433 (159 residues), 78.6 bits, see alignment E=1.4e-25 PF07517: SecA_DEAD" amino acids 301 to 401 (101 residues), 27.1 bits, see alignment E=7.2e-10 PF00271: Helicase_C" amino acids 480 to 585 (106 residues), 58.4 bits, see alignment E=2.3e-19 PF19833: RecG_dom3_C" amino acids 614 to 678 (65 residues), 47.2 bits, see alignment E=6.2e-16

Best Hits

KEGG orthology group: K03655, ATP-dependent DNA helicase RecG [EC: 3.6.4.12] (inferred from 100% identity to rpa:RPA2662)

Predicted SEED Role

"ATP-dependent DNA helicase RecG (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (700 amino acids)

>TX73_013795 ATP-dependent DNA helicase RecG (Rhodopseudomonas palustris CGA009)
MRPALLNPLFAPVTSLTGVGPKQDKLFRYLLDRDDTPRLADLLLHLPTSVIDRRARPKIR
DAVPGTVVTLEVTVDRHRAPPPGRSRAPYLVHASDDTGDVVLTFFRAKPDFVQKLLPVGA
KRYISGTGQLYDGTLQIVHPDRVVDEEGFAKLPQIDSVYPLTEGLAIGSLRRAVAQALTK
LPALPEWISPEVLRRCRFPSFADALKHVHIPDQPTDILPDGPYWSRLAYDELLAGQLALA
LVRAQLRRPAGSRNAGDGRLRHKIIDALPYALTNSQQQAAAAIAEDLRQPVRMLRLLQGD
VGSGKTVVALLAAAAVAEAGKQAALMAPTEILARQHIKTIAPLAERAGMQVAILTGREKG
KERREILERLAAGEIDFLVGTHALIQDDVIYKSLALAVVDEQHRFGVRERLALTSKGADV
DVLVLSATPIPRTLVLTYFGDMDVSELREKPAGRQPIDTRTLSDTRLPEVIDGIGRAIAA
GKRVYWICPLVEESENVKLTDAEQRFESLRQRFGDHQVGLVHGRMRGSDKDLVMGQFARG
EISVLVATTVVEVGVDVPEASIMVIENAERFGLAQLHQLRGRIGRGSEASTCLLLYREPL
GELSGARLRVIRDTTDGFRIAEEDLKLRGEGDVLGTRQSGLPGYRIARSEVHAQLITQAR
DEALRILKDNPKLEGPSGEALRCLLYLYERDEAIPLLGAG