Protein Info for TX73_013780 in Rhodopseudomonas palustris CGA009

Annotation: bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 TIGR01173: UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase" amino acids 8 to 439 (432 residues), 480.3 bits, see alignment E=3e-148 PF00483: NTP_transferase" amino acids 8 to 157 (150 residues), 33.4 bits, see alignment E=9.3e-12 PF01128: IspD" amino acids 8 to 130 (123 residues), 35.4 bits, see alignment E=2.5e-12 PF12804: NTP_transf_3" amino acids 9 to 136 (128 residues), 62.5 bits, see alignment E=1.4e-20 PF00132: Hexapep" amino acids 269 to 302 (34 residues), 30.2 bits, see alignment 6.3e-11 amino acids 304 to 335 (32 residues), 27.5 bits, see alignment (E = 4.6e-10) amino acids 381 to 415 (35 residues), 35.4 bits, see alignment 1.5e-12 PF14602: Hexapep_2" amino acids 381 to 415 (35 residues), 31.9 bits, see alignment 2.3e-11

Best Hits

Swiss-Prot: 100% identical to GLMU_RHOPA: Bifunctional protein GlmU (glmU) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K04042, bifunctional UDP-N-acetylglucosamine pyrophosphorylase / Glucosamine-1-phosphate N-acetyltransferase [EC: 2.3.1.157 2.7.7.23] (inferred from 100% identity to rpa:RPA2659)

Predicted SEED Role

"N-acetylglucosamine-1-phosphate uridyltransferase (EC 2.7.7.23) / Glucosamine-1-phosphate N-acetyltransferase (EC 2.3.1.157)" in subsystem Peptidoglycan Biosynthesis or Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 2.3.1.157, EC 2.7.7.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.157 or 2.7.7.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (452 amino acids)

>TX73_013780 bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU (Rhodopseudomonas palustris CGA009)
MTARNSLTIVLAAGEGTRMRSSLPKVLNPVAGRSLLAHVLSAAPHGERDRLAVVIGPDHQ
AVGDEAKRVRSDAAIHIQAQRLGTAHAVLAAREAIAQGADDLLIAFGDTPLISAETFARL
REPLHDGSSLVVLGFRAADPTGYGRLVVQDGKLTAIREQADASADELKITLCNAGVMAID
GKIALDVLDKIGNANAKGEYYLTDAVGIVRDLGLTASVIETSEDEVRGINTKAQLAEAET
VMQTRLRLAAMAAGVTLIAPETVYLAADTTFGKDVVIEPFVVIGPGVSIADGAVIHSFSH
LTEAKIGSKAQVGPYARLRPGTSLGDGAKIGNFVETKAAQIDAGAKVNHLTYIGDAHIGA
SANIGAGTITCNYDGFDKHKTEIGAGAFIGSNSSLVAPVKIGTGAYVGSGSVITKDVPDG
ALAVERNVQTAKDGWAKRFRDAKSRHRKPKAH