Protein Info for TX73_013660 in Rhodopseudomonas palustris CGA009

Annotation: FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01494: FAD_binding_3
  • amino acids 31 to 64 (34 residues), 25.9 bits, 1.4e-09
• PF01266: DAO
  • amino acids 33 to 387 (355 residues), 232.3 bits, E=3.1e-72
• PF00890: FAD_binding_2
  • amino acids 33 to 76 (44 residues), 28.6 bits, 2.2e-10
• PF13450: NAD_binding_8
  • amino acids 36 to 76 (41 residues), 26.9 bits, 1.2e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA2638)

Predicted SEED Role

"L-pipecolate oxidase (1.5.3.7)" in subsystem Lysine degradation

MetaCyc Pathways

• L-lysine degradation V (3/9 steps found)
• L-lysine degradation II (L-pipecolate pathway) (2/9 steps found)
• superpathway of L-lysine degradation (13/43 steps found)

Protein Sequence (434 amino acids)

>TX73_013660 FAD-dependent oxidoreductase (Rhodopseudomonas palustris CGA009)
MTTTDVSWPKSLWHAVTGPGPGLPALHGAEEADVVVVGGGFSGLSTALHLREAGVDVAVV
EAAEPGWGASGRNNGQVIPTLSRPDPEDIVAKHGAAGERLVGLIRDSASILFDVAKRHGV
DAEQEQNGWVQPVHSPGRIKIAERRFRQWSKFGAPVELLSRDQVRDMLGSEAWFGGFWNR
TGGHVNPLALARGLARAVLAQGGRIFARSPAVSIERRGDRWIVKTAQGEISGRALVVASN
AYTGEFSKTLAPAIASEVMPVRSWQMATQPLSDNVRKTIIPGRQAMSDTHGELIFGRFDA
RNRFVTGGAIIRPFNQIATLKARVGKRLQRLWPQIGEVRFDYVWNGFIGMTTDYLPHIHR
LGPNAYGWTGCNGRGVALSVALGRELSKAVRGVTDGELALPFTEPTPIPANELLRPFAPL
MMVLYRHRDAKEIG