Protein Info for TX73_013520 in Rhodopseudomonas palustris CGA009

Annotation: aliphatic sulfonate ABC transporter permease SsuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 114 to 131 (18 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 177 to 195 (19 residues), see Phobius details amino acids 200 to 220 (21 residues), see Phobius details amino acids 227 to 247 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 88 to 257 (170 residues), 99.7 bits, see alignment E=8.5e-33

Best Hits

Swiss-Prot: 62% identical to SSUC_ECOLI: Putative aliphatic sulfonates transport permease protein SsuC (ssuC) from Escherichia coli (strain K12)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 99% identity to rpt:Rpal_2882)

MetaCyc: 62% identical to aliphatic sulfonate ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-56-RXN [EC: 7.6.2.14]

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (268 amino acids)

>TX73_013520 aliphatic sulfonate ABC transporter permease SsuC (Rhodopseudomonas palustris CGA009)
MSLVETLARPRAWRLPRPDGLIQWIVPLLIILVWQAACSLGFVSARVLPAPSDVIVAGWK
LLQSGELVRNIWVSFWRASVGFAIGGSIGFAFGLANGLSSLSAKLSDTTLQMVRNVPHLA
LIPLVILWFGIDEEAKLFLVALGVFFPIYLNTLHGIRSVDPQLIEMGRIYGMSNVELFRR
VIFPGALPSVFVGVRFALGIMWLTLIVAETIAASSGLGYMAMQAREFMLIDVVVLSILIY
ALLGKLADSASRLLERQTLSWHPAFQRS