Protein Info for TX73_013100 in Rhodopseudomonas palustris CGA009

Annotation: OpgC domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 transmembrane" amino acids 48 to 67 (20 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 148 to 166 (19 residues), see Phobius details amino acids 172 to 188 (17 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details amino acids 233 to 253 (21 residues), see Phobius details amino acids 277 to 296 (20 residues), see Phobius details amino acids 317 to 335 (19 residues), see Phobius details amino acids 342 to 364 (23 residues), see Phobius details PF10129: OpgC_C" amino acids 12 to 368 (357 residues), 482.9 bits, see alignment E=5.9e-149 PF01757: Acyl_transf_3" amino acids 15 to 365 (351 residues), 35.6 bits, see alignment E=5.6e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA2536)

Predicted SEED Role

"Bll4413 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (424 amino acids)

>TX73_013100 OpgC domain-containing protein (Rhodopseudomonas palustris CGA009)
MEIQAILPSKGRDLRLDLFRGVANWAIYLDHIPNNVVNWITTRNWGFSDAADLFVFISGY
TASFVYAKMMLERGFIVGGTRLTKRVWQLYVAHIVLFVIYIVAIGYVAQRFSDPEIINEF
NVAGLVANPIETLRQGLLLKFKPVNLDVLPLYIVLMGLFPPVLWLMLRRPDAVMIGSFVL
YFAARYFEWNLQAFPEGTWYFNPFCWQLLFVFGAWCALGGTVRSRSIIASRGMLWFCLAY
LVFALVMTMAGRFQDFGDLFPRWLYDAFNPNDKTNLAPYRFLHFAVIVVLVIRFVPKDWK
GLEWRGFDPLIKCGQQSLAVFCVGVFLSFVAHFELTMSSGSLMAQILVSVIGIALMTLVA
YYISWSKQQDKPARPAAKPATQAAPAAPAAASGLEAQPARSQLQDSGVPAVSPAMIAAAQ
SSPE