Protein Info for TX73_012995 in Rhodopseudomonas palustris CGA009

Annotation: lysine-2,3-aminomutase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 TIGR00238: KamA family protein" amino acids 13 to 322 (310 residues), 265.3 bits, see alignment E=6.9e-83 TIGR03822: lysine-2,3-aminomutase-related protein" amino acids 15 to 334 (320 residues), 553.8 bits, see alignment E=1.1e-170 PF13353: Fer4_12" amino acids 106 to 176 (71 residues), 24 bits, see alignment E=6.5e-09 PF04055: Radical_SAM" amino acids 109 to 258 (150 residues), 47.8 bits, see alignment E=2.8e-16 PF12544: LAM_C" amino acids 302 to 334 (33 residues), 27.8 bits, see alignment 3.7e-10

Best Hits

KEGG orthology group: K01843, lysine 2,3-aminomutase [EC: 5.4.3.2] (inferred from 100% identity to rpa:RPA2515)

Predicted SEED Role

"Lysyl-lysine 2,3-aminomutase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (363 amino acids)

>TX73_012995 lysine-2,3-aminomutase-like protein (Rhodopseudomonas palustris CGA009)
MTKVTRLNTPAAATLRQPDELIAEGLAAADDRAMLSEVAARYAIAVTPAVAALIDRADPD
DPIARQYIPSAEELSSLAFERDDPIGDAAHAPVEGIVHRHRDRVLFKPVHVCAVYCRFCF
RREMVGPGKDNALSREATAAALDYIRAHDEIWEVIFTGGDPLMLSPRRLAEIMAELAAIE
HVKIVRFHTRLPVADPARITPDLVRALRAPGKTTWLALHANHPRELTGDARAACARIVDA
GIPMVSQSVLLRGVNDDAATLEALMRAFVECRIKPYYLHHGDLAPGTAHLRTTLAEGQAL
MRALRGNVSGLCQPEYVLDIPGGYGKAPVGPNYLSDADGTGRDSRYRVADYCGEVHLYPP
LSE