Protein Info for TX73_012970 in Rhodopseudomonas palustris CGA009

Annotation: FUSC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 transmembrane" amino acids 32 to 52 (21 residues), see Phobius details amino acids 57 to 72 (16 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 105 to 125 (21 residues), see Phobius details amino acids 132 to 150 (19 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details amino acids 250 to 267 (18 residues), see Phobius details amino acids 272 to 289 (18 residues), see Phobius details amino acids 294 to 313 (20 residues), see Phobius details amino acids 325 to 343 (19 residues), see Phobius details PF13515: FUSC_2" amino acids 211 to 337 (127 residues), 97.9 bits, see alignment E=2.5e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA2510)

Predicted SEED Role

"COGs COG1289"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (372 amino acids)

>TX73_012970 FUSC family protein (Rhodopseudomonas palustris CGA009)
MMRHHWTWHRIKALAHEEWRELVTFNPSDRPWQMPFSAALAAGVPMLIGAYFDHLDYGLI
SSLGGMAFLYLPRTPLHHRMVSMMAAGFGYAACYTLGLVVHLLPWLLVPAITFTAILVTM
LCRFYRVGPPGSMFFVMAAAIAAYTPGDLMQLPLKAGLFVLGSLLATLIAMIYSVVVLRI
RDPLPVPPLATDDFEHVVLDAVVIGVFVGGALALAQALQLERPYWVPVSCLAVIQGLSVR
AIWNRHLHRLLGTAIGLGLAAVLLALPLEKWSIAFAVIALSFVIETAVIRHYGFAVIFIT
PLTIFLADAATLGQEPVHQIIEARFIDTVVGCVVGLVGGVCLHHPGFRHVTAGLIRRLIP
AYLIPAKHDRGD