Protein Info for TX73_012960 in Rhodopseudomonas palustris CGA009

Annotation: single-stranded-DNA-specific exonuclease RecJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 613 transmembrane" amino acids 214 to 233 (20 residues), see Phobius details amino acids 256 to 276 (21 residues), see Phobius details TIGR00644: single-stranded-DNA-specific exonuclease RecJ" amino acids 51 to 600 (550 residues), 512 bits, see alignment E=7.7e-158 PF01368: DHH" amino acids 104 to 228 (125 residues), 71.9 bits, see alignment E=9.4e-24 PF02272: DHHA1" amino acids 349 to 474 (126 residues), 89.1 bits, see alignment E=5.8e-29 PF17768: RecJ_OB" amino acids 492 to 601 (110 residues), 74.8 bits, see alignment E=8.2e-25

Best Hits

KEGG orthology group: K07462, single-stranded-DNA-specific exonuclease [EC: 3.1.-.-] (inferred from 100% identity to rpt:Rpal_2787)

Predicted SEED Role

"Single-stranded-DNA-specific exonuclease RecJ (EC 3.1.-.-)" in subsystem DNA-replication or DNA Repair Base Excision or DNA repair, bacterial RecFOR pathway (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (613 amino acids)

>TX73_012960 single-stranded-DNA-specific exonuclease RecJ (Rhodopseudomonas palustris CGA009)
MTPPISVLPAETVPAFLGVTRSATGKAWRDRLDARATAKAQAMVQRYQLPEMLARVLAGR
GVEIDQVEDFLEPTIRKLMPDPASLTQMEAGAKRIADAASRGEKVAIFGDYDVDGATSSA
LLAWHLRHCGLDPLIHIPDRIFEGYGPNIDAIRMLAGKGATLLITVDCGTTSLEPLAEAR
RLGMSVVVIDHHQCGDELPDVDALINPNRPDDLSGLGHLAAVGLVLMTLVAVNRELRHRG
FWTTERPEPNLLDMLHHVALGTVADVAPLVGLNRAFVAKGLIAMRRRDHVGHTALMDVSR
LNGPPEAWHLGFMLGPRINAGGRIGRADLGVRLLLESDVSEAARIAAELDRLNSERREIE
QKAEAQAEAEAMASLGLEDKGAVIVTASEGWHPGVVGLVASRLKEKFGRPSFAIALEPGG
IGTGSGRSISGVDLGKAVRQAVHDGLLLKGGGHAMAAGVTLRKERLAEFRAWLETTLAGD
VAKSRHVNELYIDGAVSARGVTTDLAATLNRAGPFGAGNPEPIVALPAHQLIYADEVGQA
HLRLRFKAGDGAIVNGIAFRSVGQKLGNALTENRGQTLHVAGSLSVDRWQGAERVQLRVI
DVAVPDAGPTMIR