Protein Info for TX73_012855 in Rhodopseudomonas palustris CGA009

Annotation: DedA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 transmembrane" amino acids 21 to 54 (34 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 113 to 136 (24 residues), see Phobius details amino acids 148 to 173 (26 residues), see Phobius details PF09335: SNARE_assoc" amino acids 39 to 163 (125 residues), 70.5 bits, see alignment E=9.6e-24

Best Hits

KEGG orthology group: None (inferred from 99% identity to rpt:Rpal_2766)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (176 amino acids)

>TX73_012855 DedA family protein (Rhodopseudomonas palustris CGA009)
MEAYIHDIAEFVRQHEAWAAPVVLALAFGESLAFVSLLIPAWGALVAIGALIGVSGLSFW
PVWIAGGVGAALGDWVSYWFGYRYKDNVAQIWPLSKYPGLLRRGEDFVRKWGVPSIFIGR
FFGPLRASVPLAAGIFEMPFWPFQIANVVSALVWSAVLLLFGDGLSIGLGWMLRSV