Protein Info for TX73_012760 in Rhodopseudomonas palustris CGA009

Annotation: SUF system Fe-S cluster assembly protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 TIGR02945: FeS assembly SUF system protein" amino acids 26 to 122 (97 residues), 154 bits, see alignment E=6.1e-50 PF01883: FeS_assembly_P" amino acids 28 to 99 (72 residues), 73.5 bits, see alignment E=6.6e-25

Best Hits

Swiss-Prot: 42% identical to SUFT_BACSU: Fe-S protein maturation auxiliary factor YitW (yitW) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 98% identity to rpb:RPB_2989)

Predicted SEED Role

"PaaD-like protein (DUF59) involved in Fe-S cluster assembly"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (122 amino acids)

>TX73_012760 SUF system Fe-S cluster assembly protein (Rhodopseudomonas palustris CGA009)
MTDTIEAKANMQTVSALPPEETERLGTEIVAALKTVFDPEIPADIYELGLIYKVEIKDDR
TVDIDMTLTTPNCPAAAELPTMVENAVASVPGVGVVNVNIVWEPPWTPERMSDEARLVLN
MW