Protein Info for TX73_012660 in Rhodopseudomonas palustris CGA009

Annotation: dicarboxylate/amino acid:cation symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 23 to 42 (20 residues), see Phobius details amino acids 62 to 83 (22 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 165 to 183 (19 residues), see Phobius details amino acids 196 to 222 (27 residues), see Phobius details amino acids 234 to 257 (24 residues), see Phobius details amino acids 323 to 352 (30 residues), see Phobius details amino acids 364 to 388 (25 residues), see Phobius details amino acids 399 to 416 (18 residues), see Phobius details PF00375: SDF" amino acids 25 to 414 (390 residues), 364.4 bits, see alignment E=3.7e-113

Best Hits

Swiss-Prot: 100% identical to DCTA_RHOPA: C4-dicarboxylate transport protein (dctA) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K11103, aerobic C4-dicarboxylate transport protein (inferred from 100% identity to rpa:RPA2448)

MetaCyc: 59% identical to C4 dicarboxylate/orotate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN-121A; TRANS-RXN-121C; TRANS-RXN-122A; TRANS-RXN0-451; TRANS-RXN0-517; TRANS-RXN0-553

Predicted SEED Role

"C4-dicarboxylate transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>TX73_012660 dicarboxylate/amino acid:cation symporter (Rhodopseudomonas palustris CGA009)
MSATTHIDAPALPKRGKSKPFYKVLYVQVLFAIVVGVLVGWLSPHFATNEWIKALGDGFV
KLIKMVIAPIIFCTVVSGIAHIQDARKVGRVGIKALLYFEVVSSFALVLGLIVGNLFPVG
HGLAAKPDAGAVAKYVDQASHMSAVDFVLHIIPDSVVGAFAKGDILQVLLFAVLFGFALM
ALGERGHRLRDVIDDAAHAVFGVIAIVMKAAPIGAFGAMAFTIGKYGPAALGNLIGLVAL
FYATSALFVVLVLGTIAKFVGFNIFKFIGYIKDELLIVLGTSSSESALPQLMEKLERLGC
SKSVVGLVVPTGYSFNLDGTNIYMTLATLFIAQALGIELSFGDQVAILLVAMLTSKGASG
VTGAGFVTLAGTLAAVNPALVPGMAIVFSIDKFMSEVRALTNITGNGVAAVFVSWWEGEL
DHDRLRANLSRNVDPSDVETAVTTG