Protein Info for TX73_012640 in Rhodopseudomonas palustris CGA009

Annotation: BA14K family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 129 signal peptide" amino acids 1 to 51 (51 residues), see Phobius details transmembrane" amino acids 74 to 92 (19 residues), see Phobius details PF07886: BA14K" amino acids 101 to 129 (29 residues), 51.2 bits, see alignment 4.7e-18

Best Hits

KEGG orthology group: None (inferred from 99% identity to rpt:Rpal_2722)

Predicted SEED Role

"FIG01007471: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (129 amino acids)

>TX73_012640 BA14K family protein (Rhodopseudomonas palustris CGA009)
MTNSIRPSGNKPRKFITRALASVALLTMYGLGMIATTSAAMTLASTPAHAQRGWGRGRGR
GWDRGRGRGWGGPGAAVGIGIGAAIVGGAIAASQAEAARQQDYCARRFRSYNPATGTYIA
KGGREVPCP