Protein Info for TX73_012570 in Rhodopseudomonas palustris CGA009

Annotation: citrate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 transmembrane" amino acids 5 to 25 (21 residues), see Phobius details amino acids 31 to 50 (20 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 108 to 133 (26 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details amino acids 222 to 241 (20 residues), see Phobius details amino acids 252 to 270 (19 residues), see Phobius details amino acids 280 to 300 (21 residues), see Phobius details amino acids 310 to 331 (22 residues), see Phobius details amino acids 340 to 363 (24 residues), see Phobius details amino acids 379 to 399 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA2430)

Predicted SEED Role

"Arsenic efflux pump protein" in subsystem Arsenic resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (405 amino acids)

>TX73_012570 citrate transporter (Rhodopseudomonas palustris CGA009)
MTPILILGIPLDFILFAATLVGVAIFHRHTLLIALAGLVTVVGYKLAFAGFKTGVGLSGL
ALHMQHEWVTLANLFLLLMGFALLSAHFEKSGIPDEMPALLPDDWKGPVVLLGLVFVLSS
FLDNIAAALIGGMVARHVFRGRVHIGYLAAIVAASNAGGSGSVVGDTTTTMMWIAGVSPL
SVLEAYVAAVIALALFAVPASIQQQKFSPIVKNAPKGLQIEWVRVGIVAAILIAALAANV
TANMKFPALLDHAPVLGLTVWAVILITAPLRRPDWELMPATFKGTIFLLALVTAASLMPV
EELPAASWQTALGLGFVSAGFDNIPLTALALKQGGYDWGFLAYAVGFGGSMMWFGSSAGV
AITNMFPEGKSVVMWLRHGWHVGVAYFIAFFAMLLLVGWHPDLPR