Protein Info for TX73_012370 in Rhodopseudomonas palustris CGA009

Annotation: methylisocitrate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 TIGR02317: methylisocitrate lyase" amino acids 15 to 296 (282 residues), 434.6 bits, see alignment E=7.5e-135 PF13714: PEP_mutase" amino acids 18 to 254 (237 residues), 151.5 bits, see alignment E=3e-48 PF00463: ICL" amino acids 88 to 181 (94 residues), 40.3 bits, see alignment E=1.6e-14

Best Hits

Swiss-Prot: 53% identical to MMGF_BACSU: 2-methylisocitrate lyase (mmgF) from Bacillus subtilis (strain 168)

KEGG orthology group: K01003, carboxyvinyl-carboxyphosphonate phosphorylmutase [EC: 2.7.8.23] (inferred from 100% identity to rpa:RPA2395)

MetaCyc: 44% identical to 2-methylcitrate lyase (Cupriavidus necator)
Methylisocitrate lyase. [EC: 4.1.3.30]

Predicted SEED Role

"Methylisocitrate lyase (EC 4.1.3.30)" in subsystem Methylcitrate cycle or Propionate-CoA to Succinate Module (EC 4.1.3.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.23

Use Curated BLAST to search for 2.7.8.23 or 4.1.3.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>TX73_012370 methylisocitrate lyase (Rhodopseudomonas palustris CGA009)
MPYLVAADLPTDPAGVRFRSLIERGGIVRMPGAHNGMAALQARAAGFEALYLSGAAMTAS
MGIPDLGMITVDEVTFFIRQIARAGGLPTLVDGDTGYGEALNVMHMVRTFEDAGAGAVHI
EDQLLPKKCGHLNDKKLADANDMAAKVAAAAKARRHLYLIARTDAAASEGIDGAVARAKL
YIEAGADAIFPEALTTAEMFREFAARMPGVPLLANMTEFGRTPFFTADEFQQMGYRMVIW
PVSSLRVANKVQQKLYATLHRDGSTQAMLGDMQTRAELYETLGLDRFEALDASIVRSIAP
DSVGS