Protein Info for TX73_012315 in Rhodopseudomonas palustris CGA009

Annotation: iron chelate uptake ABC transporter family permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 142 to 165 (24 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details amino acids 231 to 255 (25 residues), see Phobius details amino acids 272 to 291 (20 residues), see Phobius details amino acids 300 to 319 (20 residues), see Phobius details PF01032: FecCD" amino acids 20 to 320 (301 residues), 222.6 bits, see alignment E=3.2e-70

Best Hits

Swiss-Prot: 45% identical to YCLN_BACSU: Petrobactin import system permease protein YclN (yclN) from Bacillus subtilis (strain 168)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to rpa:RPA2384)

Predicted SEED Role

"InterPro IPR000522 COGs COG0609"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>TX73_012315 iron chelate uptake ABC transporter family permease subunit (Rhodopseudomonas palustris CGA009)
MIAVERTASRSAGATALLALVALFVVSIFVGVGEVAPRDVFTSPDALYLVVASRLPRTLA
AVLTGAGLAIAGLVMQTLARNRFVEPTTAGTGQSAALGILLVALLLPSASIATKTLVASL
TALAGTSLFLAIAHRLPPTQPFLVPLFGLVYGGVVGAAVTFVAWHTDLLQFIEIWTNGEF
SGVLRGRYELLWASAAVLAMTWVFADRLTLMSLGRDVSVGLGLDYARMMQIGLLIISIVT
ALTVVIVGMIPFVGLVVPNMVSRLIGDNMRSLIPWVAGSGAALVLACDIIGRLLHFPYEI
PVGTVLGVVGAASFLWLLLRRPSHA