Protein Info for TX73_012310 in Rhodopseudomonas palustris CGA009

Annotation: iron chelate uptake ABC transporter family permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 40 to 61 (22 residues), see Phobius details amino acids 78 to 99 (22 residues), see Phobius details amino acids 105 to 124 (20 residues), see Phobius details amino acids 130 to 154 (25 residues), see Phobius details amino acids 176 to 196 (21 residues), see Phobius details amino acids 222 to 252 (31 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details amino acids 290 to 312 (23 residues), see Phobius details PF01032: FecCD" amino acids 34 to 311 (278 residues), 136.6 bits, see alignment E=5e-44

Best Hits

Swiss-Prot: 39% identical to YCLO_BACSU: Petrobactin import system permease protein YclO (yclO) from Bacillus subtilis (strain 168)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to rpa:RPA2383)

Predicted SEED Role

"Petrobactin ABC transporter, permease protein II"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>TX73_012310 iron chelate uptake ABC transporter family permease subunit (Rhodopseudomonas palustris CGA009)
MRDRSTIVLATLGAFALACIAAYMTVGLRGNLWFALELRAVRLAALIVVAVSIAVSTVVF
QTVTTNRILTPSIMGLDALYVFSQSLLVFAVGGLGFAALDPRLKFAGEATVMVILAALLF
LPLLKARMDLILMLLTGVTVGVLFRSLSSLLARLIDPNDFVVLQSASYANFSKIHGELLV
ASCALTLVGIAIVWRLRHVLDVLALGRDVSTGLGLEWPRVVAGMIMLVAALVAVSTALVG
PVAFFGLLVVALGERLLDTRRHAILLPAAALVSVIVLVGGQTILQHVLGGASTLGVVIEF
VGGLVFLAMLLHGVRR