Protein Info for TX73_012265 in Rhodopseudomonas palustris CGA009

Annotation: glycosyltransferase family 39 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 535 transmembrane" amino acids 46 to 68 (23 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 144 to 162 (19 residues), see Phobius details amino acids 168 to 185 (18 residues), see Phobius details amino acids 191 to 223 (33 residues), see Phobius details amino acids 235 to 260 (26 residues), see Phobius details amino acids 284 to 304 (21 residues), see Phobius details amino acids 324 to 344 (21 residues), see Phobius details amino acids 350 to 370 (21 residues), see Phobius details amino acids 376 to 403 (28 residues), see Phobius details PF13231: PMT_2" amino acids 93 to 253 (161 residues), 102.3 bits, see alignment E=1.8e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpt:Rpal_2617)

Predicted SEED Role

"FIG01005859: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (535 amino acids)

>TX73_012265 glycosyltransferase family 39 protein (Rhodopseudomonas palustris CGA009)
MTLANAEALRRDPGAASSGPAMIRYCWLQRAFRRGAAALVHPRLGAPLLLGVVLGNALLW
VAALAILKFAQVLHSDSTEAFAWGQTLAWGSGKHPPMAGWVARAWFSVFPTSDWAFYALA
MAVTGATVLLIRLLAGEVVDRRRAVLATLLAMIYPILNFKGYKFNPDLLQLPFVVLIVWA
YMVAAERRTALWGVVIGLAGNGAVMTKYWGAWALVAIAVAAVTRPDRNRLFRSPVPYVAV
AVFVLAIGPHLDWLSAVGFTPFRYASQFFVVDRGTAARHSIDSTLHAFALLLPALVAGAV
AVLLPRFRRVTPPPDDAVERARQIWLIVAVLVIGPIIAAIALPVRMKSDWTIPLFSLVPL
AVLALPRLAVPLRAVARAAVILLMLGVGALIAAPGLATVKVLFEPNRALSPRLDRLATIA
TDLWRERAGTPLRIVVGDSEEIATVSFYSADHPRMFLAGAPELTPWISAETLGRSGFVGI
CPAAAPACVDRVIALRPRAEQIAVTTERSALGQTLPPDRWVMLLALPEADAEVTR