Protein Info for TX73_012180 in Rhodopseudomonas palustris CGA009

Annotation: cystathionine beta-synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 PF00291: PALP" amino acids 19 to 311 (293 residues), 263 bits, see alignment E=3.7e-82 PF00571: CBS" amino acids 354 to 397 (44 residues), 29.9 bits, see alignment 5.8e-11 amino acids 411 to 461 (51 residues), 22.5 bits, see alignment 1.2e-08

Best Hits

KEGG orthology group: K01697, cystathionine beta-synthase [EC: 4.2.1.22] (inferred from 100% identity to rpt:Rpal_2600)

Predicted SEED Role

"Cystathionine beta-synthase (EC 4.2.1.22)" in subsystem Cysteine Biosynthesis or Glycine and Serine Utilization or Methionine Biosynthesis or Methionine Degradation (EC 4.2.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (465 amino acids)

>TX73_012180 cystathionine beta-synthase (Rhodopseudomonas palustris CGA009)
MSLARLATPKDRTPKGLIDLIGNTPLVQLTRLDAGPCRLFAKLEGQNPGGSIKDRPALAM
IEAFERSGELRPGGTLVEATAGNTGLGLALIAALKGYRLVLVIPDKMSREKVLHLKAMGA
EVVMTRSDVGKGHPAYYQDLAQKITSETPGAVFVNQFANPANPLAHEYGTAPEIWEQMDR
RVDAVVCGIGSGGTLTGIARFFQRASPSTEIILADPKGSVLVDVVEGREPGPVGSWLVEG
IGEDFVPSNAELKLVTRGYTVTDAESFHAARELLRREGILAGSSSGTLLAAALRYCREQT
RPKRVVTLLPDGGNKYLSKMFNDTWMADQGFVPRRHDGDLRDLIVRRHDEGASITVAPED
TLNFAYSRMKLYEVSQLPVLVDDRVVGIIDESDLLMATIGDPAKFAEPVHSAMSKRVETV
EASAPFESLMPVFDRGLVVVVVDGSRFLGLITRIDLINHLRSKVH