Protein Info for TX73_012000 in Rhodopseudomonas palustris CGA009

Annotation: tripartite tricarboxylate transporter TctB family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 65 (22 residues), see Phobius details amino acids 88 to 117 (30 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details PF07331: TctB" amino acids 13 to 153 (141 residues), 62.2 bits, see alignment E=3.1e-21

Best Hits

KEGG orthology group: None (inferred from 98% identity to rpt:Rpal_2564)

Predicted SEED Role

"Tricarboxylate transport protein TctB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (158 amino acids)

>TX73_012000 tripartite tricarboxylate transporter TctB family protein (Rhodopseudomonas palustris CGA009)
MSVRRRLDHRDGAAGLAFFVFGIGFAVLALNYPLGTTMRMGPGYFPVVLGLILAGLGLVV
GLGAFRSQSVADQGAGNASLAIPKLRPALLISASVLVFAAAIESVGLALATFGVVAVSSL
ANSNVRWRSIAASGLVLASASVAIFAYGLRLPFRVTPF