Protein Info for TX73_011685 in Rhodopseudomonas palustris CGA009

Annotation: arsenical resistance protein ArsH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 TIGR02690: arsenical resistance protein ArsH" amino acids 28 to 228 (201 residues), 399.2 bits, see alignment E=1.6e-124 PF03358: FMN_red" amino acids 35 to 179 (145 residues), 103.3 bits, see alignment E=5e-34

Best Hits

Swiss-Prot: 79% identical to ARREH_SHIFL: NADPH-dependent FMN reductase ArsH (arsH) from Shigella flexneri

KEGG orthology group: K11811, arsenical resistance protein ArsH (inferred from 100% identity to rpa:RPA2259)

MetaCyc: 68% identical to ArsH (Pseudomonas putida KT2440)

Predicted SEED Role

"Arsenic resistance protein ArsH" in subsystem Arsenic resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>TX73_011685 arsenical resistance protein ArsH (Rhodopseudomonas palustris CGA009)
MPLRTLSDPDHLPALDRRYALDRPALGLGAGDPPPRILLLYGSLRERSYSRLCVEEAARL
LQFFGCETHIFDPSTLPLPDQVNGDDHPAVHELRKLSMWSEGHVWCSPERHGQVTGIMKT
QIDHLPLNMGGMRPTQGRTLAVMQVSAGSQSFNSVNTLRILGRWMRMFTIPNQSSVAKAF
NEFDEAGRMKPSSYYDRIVDVMEELVRFTVLMRPHAAQLVDRYSERKEAGVPIDIATDLS
AIATAGARGKS