Protein Info for TX73_011370 in Rhodopseudomonas palustris CGA009

Annotation: glutamine-hydrolyzing GMP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain
  • amino acids 30 to 218 (189 residues), 232.4 bits, E=2.8e-73
• PF00117: GATase
  • amino acids 31 to 215 (185 residues), 142.7 bits, E=2.8e-45
• PF07722: Peptidase_C26
  • amino acids 95 to 198 (104 residues), 32.6 bits, E=1.8e-11
• TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain
  • amino acids 228 to 540 (313 residues), 480 bits, E=3.3e-148
• PF02540: NAD_synthase
  • amino acids 232 to 275 (44 residues), 27.1 bits, 5.6e-10
• PF03054: tRNA_Me_trans
  • amino acids 244 to 275 (32 residues), 22.2 bits, see alignment (E = 2.5e-08)
• PF00958: GMP_synt_C
  • amino acids 449 to 539 (91 residues), 142.6 bits, E=8e-46

Best Hits

Swiss-Prot: 100% identical to GUAA_RHOPA: GMP synthase [glutamine-hydrolyzing] (guaA) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 100% identity to rpa:RPA2203)

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• superpathway of purine nucleotide salvage (11/14 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.2

Use Curated BLAST to search for 6.3.5.2

Protein Sequence (540 amino acids)

>TX73_011370 glutamine-hydrolyzing GMP synthase (Rhodopseudomonas palustris CGA009)
MTAPSTSSASSVVPSGADTSPHVAAIHEKILIVDFGSQVTQLIARRVREEGVYSEIVPFQ
KAEAAFAEMKPKAVILSGGPASVLDDNAPSAPMTILEAGVPVLGICYGEQTLAKQLGGTV
EGGHHREFGRAQIEITDDCALFDGIWQKGGKYDVWMSHGDRVTKLPAGFRAVAQAPGSPI
SVIADDTRKFYAMQFHPEVVHTPDGAKLLSNFVRKVAGLTGDWTMRAFREEAIEKIRAQV
GTGKVICGLSGGVDSAVAAVLIHEAIGDQLTCVFVDHGLLRKDEGKSVVDLFRHHYNIPL
VHVDVSETFLGALKGVTDPEQKRKTIGKLFIDVFEAEARRVGGADFLAQGTLYPDVIESV
SFTGGPSVTIKSHHNVGGLPERMNMKLVEPLRELFKDEVRALGRELGLPDVFVGRHPFPG
PGLAIRCPGEITEEKLEILRNADAVYIDQIRKAGLYDVIWQAFAVLLPVRSVGVMGDGRT
YDYVVGLRAVTSTDGMTADFYPFEMSFLGATATRIINEVKGVNRVVYDVTSKPPGTIEWE