Protein Info for TX73_011335 in Rhodopseudomonas palustris CGA009

Annotation: RlmE family RNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 PF01728: FtsJ" amino acids 44 to 222 (179 residues), 196.7 bits, see alignment E=1.6e-62

Best Hits

Swiss-Prot: 100% identical to RLME_RHOPA: Ribosomal RNA large subunit methyltransferase E (rlmE) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K02427, ribosomal RNA large subunit methyltransferase E [EC: 2.1.1.-] (inferred from 100% identity to rpt:Rpal_2491)

MetaCyc: 44% identical to 23S rRNA 2'-O-ribose U2552 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11845 [EC: 2.1.1.166]

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.166

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (237 amino acids)

>TX73_011335 RlmE family RNA methyltransferase (Rhodopseudomonas palustris CGA009)
MAKDTTGRMRVTVKSGGRMKLSSKLWLERQLNDPYVAQAKRDGYRSRAAYKLTEIDDKFR
LLKSGMAVVDLGAAPGGWSQVAAKKVGAADGRGKVVAIDLLEMGEVPGVTFAQLDFLDPS
APERLREMLGGGADIVMSDMAANTTGHRKTDQLRIVGLVETAAMFASEVLKPGGTFLAKV
FQSGADASLMTELKRDYASVKHVKPAASRKDSSERYLLATGFRGGAARDAEAAAETE