Protein Info for TX73_011305 in Rhodopseudomonas palustris CGA009

Annotation: YaiI/YqxD family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 PF02639: DUF188" amino acids 20 to 148 (129 residues), 163.7 bits, see alignment E=8.2e-53

Best Hits

Swiss-Prot: 100% identical to Y2191_RHOPA: UPF0178 protein RPA2191 (RPA2191) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K09768, hypothetical protein (inferred from 99% identity to rpt:Rpal_2485)

Predicted SEED Role

"Bll3966 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (158 amino acids)

>TX73_011305 YaiI/YqxD family protein (Rhodopseudomonas palustris CGA009)
MTDALTRIYVDADACPVKDEVYKVAERHHLPVTLVAGGFIRVPQHPLIERVAAGSGMDAA
DDWIAERIKPGDIVVTADIPLASRCVKAGATAIAPNGKPFTEESIGMTLAVRNLMTDLRS
TGEITGGPRAFSPRDRSTFLSALDSAIRRIARRRAAPT