Protein Info for TX73_011300 in Rhodopseudomonas palustris CGA009

Annotation: ATP-binding cassette domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 605 PF00005: ABC_tran" amino acids 22 to 148 (127 residues), 81.7 bits, see alignment E=4.1e-26 amino acids 299 to 433 (135 residues), 80.5 bits, see alignment E=9.5e-26 PF16326: ABC_tran_CTD" amino acids 528 to 596 (69 residues), 73.2 bits, see alignment E=7.9e-24

Best Hits

Swiss-Prot: 53% identical to HFAC_CAUVC: Holdfast attachment protein C (hfaC) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: None (inferred from 100% identity to rpa:RPA2190)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (605 amino acids)

>TX73_011300 ATP-binding cassette domain-containing protein (Rhodopseudomonas palustris CGA009)
MAPPLIQLKDIALTFGGAALFDGVELAVSAGDRLCLIGRNGSGKSTLLKIVAGLIEPDRG
SRFVQPGATVRYLPQEPDFDGFATTQAYVEAGLAPGDDHYQAAYLLEQLGLHGDENPAHL
SGGEARRAALARILAPDPDILLLDEPTNHLDLTTIEWLENDLAQRRCAIVMISHDRRFLS
NLSRATAWLDRGVIRQIDRGFSQFESWRDDVLAEEERDQHKLDRKIVMEEHWLRYGVSGR
RKRNVKRLAGLHELRAQRRDYRGPTGAASLAAAEADKSGKLVIEAKSISKAWGDRPIVDA
FSIRINRGDRVGIVGPNGAGKTTLISLLTGALAPDSGTVRLGTNLEIATLDQSRDSLDPK
STLSDALTGGRGDQVMVGGKPRHVIGYMKDFLFTQEQARTPLEALSGGERGRLMLARSLA
NPSNLLVLDEPTNDLDLETLDVLEEMLGDYDGTVILISHDRDFLDRVVTSVIAPDGGGKW
IEYAGGYSDMLAQRGADLSRQPAKAAAAEPAAAKAAPSPATAPAPKRKLSFNEKHALETL
PKTIAKLEAEIADLQKQLDDPQLFARDRAKFDKVSAAMAKAHDELHAAEHRWLELEMLRE
EIESA