Protein Info for TX73_011275 in Rhodopseudomonas palustris CGA009

Annotation: MaoC family dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 transmembrane" amino acids 60 to 76 (17 residues), see Phobius details PF01575: MaoC_dehydratas" amino acids 14 to 117 (104 residues), 81.9 bits, see alignment E=1.4e-27

Best Hits

Swiss-Prot: 57% identical to NODN_RHILV: Nodulation protein N (nodN) from Rhizobium leguminosarum bv. viciae

KEGG orthology group: None (inferred from 100% identity to rpa:RPA2185)

Predicted SEED Role

"MaoC-like dehydratase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (155 amino acids)

>TX73_011275 MaoC family dehydratase (Rhodopseudomonas palustris CGA009)
MSTELELDAYIKLVGTEIGVSEWHVLDQKRIDQFADCTEDWQYIHVDPERAARETPFGTT
IAHGFLTLSMLSVFSYEAMPKIKGVTMGVNYGFDRLRFISPVKAGSRVRGRFMLAEATLR
KPGELLSRTSVNVEIEGEKRSALVADWLGLIYFEQ