Protein Info for TX73_011030 in Rhodopseudomonas palustris CGA009

Annotation: acyl-CoA dehydrogenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02771: Acyl-CoA_dh_N
  • amino acids 4 to 118 (115 residues), 101.1 bits, E=1e-32
• PF02770: Acyl-CoA_dh_M
  • amino acids 122 to 217 (96 residues), 89.7 bits, E=2.2e-29
• PF00441: Acyl-CoA_dh_1
  • amino acids 229 to 373 (145 residues), 144.7 bits, E=5.2e-46
• PF08028: Acyl-CoA_dh_2
  • amino acids 245 to 358 (114 residues), 52.2 bits, E=1.6e-17

Best Hits

Swiss-Prot: 54% identical to IVD_CAEEL: Probable acyl-CoA dehydrogenase 6 (acdh-6) from Caenorhabditis elegans

KEGG orthology group: K11731, citronellyl-CoA dehydrogenase [EC: 1.3.99.-] (inferred from 100% identity to rpt:Rpal_2430)

MetaCyc: 67% identical to citronellyl-CoA dehydrogenase (Pseudomonas aeruginosa PAO1)
1.3.8.-

Predicted SEED Role

"Citronellyl-CoA dehydrogenase"

MetaCyc Pathways

• citronellol degradation (1/4 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Brassinosteroid biosynthesis
• Caprolactam degradation
• Fatty acid metabolism
• Geraniol degradation
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.-

Use Curated BLAST to search for 1.3.99.-

Protein Sequence (384 amino acids)

>TX73_011030 acyl-CoA dehydrogenase family protein (Rhodopseudomonas palustris CGA009)
MLFTADHDEPRRILQRFIQSDINPHVDEWENAGIFPAHELFKKLGDLGFLGLNKPVEYGG
QGLDYSYALMMAEELGAINCGGVPMAIGVQTDMATPALARFGSDELRKEFLAPSIAGDYV
ACIGVSEPGAGSDVAGIKTTAKSDGDDYVISGGKMWITNGTQADWICLLCNTGEGPVHRN
KSLICVPMKTKGVTIARKLDKLGMRSSDTAQIYFDEVRVPKRNRIGEEGKGFTYQMVQFQ
EERLWGAAACLKAHEKTIQNTIEYTRGRKAFGKPLLDNQVIHFRLAELQTEVELLRSLVY
RAAEALVAGEDVTQLATMAKLKAGRLGREIPDACLQFWGGMGFMNETLVSRSYRDSRLTA
IGGGADEVMLGILCKMNGTLPGKA