Protein Info for TX73_010990 in Rhodopseudomonas palustris CGA009

Annotation: sulfite exporter TauE/SafE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 40 to 66 (27 residues), see Phobius details amino acids 82 to 103 (22 residues), see Phobius details amino acids 115 to 135 (21 residues), see Phobius details amino acids 155 to 184 (30 residues), see Phobius details amino acids 195 to 215 (21 residues), see Phobius details amino acids 221 to 242 (22 residues), see Phobius details amino acids 250 to 267 (18 residues), see Phobius details PF01925: TauE" amino acids 15 to 264 (250 residues), 150.1 bits, see alignment E=4.1e-48

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to rpa:RPA2130)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (268 amino acids)

>TX73_010990 sulfite exporter TauE/SafE family protein (Rhodopseudomonas palustris CGA009)
MELTILEGIAIDPNYALAGAVTGFVVGLTGVGGGALMTPLLLLIFSIAPHVAIATDLWFA
AITKLIGAAVHNRRGHIDWGIVTRLWAGSLPAAGLVVAIVALSDPVGRTHWLTKTIGVVV
ILTALGIVFAPRLIAALNPATPDAEQPSRNRTSLTIMAGAVLGALVALTSIGAGALGTVL
LLYLYPRRLLPHRLVATDLAHAIPLAMVAGAGYLVAGMVDWHILASLLVGSIPAVIAGGL
SAGKLSGRKLQIALAAVLFAAGLKSLLF