Protein Info for TX73_010970 in Rhodopseudomonas palustris CGA009
Annotation: TonB system transport protein ExbD
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 66% identical to EXBD_PSEPU: Biopolymer transport protein ExbD (exbD) from Pseudomonas putida
KEGG orthology group: K03559, biopolymer transport protein ExbD (inferred from 99% identity to rpt:Rpal_2419)MetaCyc: 62% identical to Ton complex subunit ExbD (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"Biopolymer transport protein ExbD/TolR" in subsystem Ton and Tol transport systems
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (145 amino acids)
>TX73_010970 TonB system transport protein ExbD (Rhodopseudomonas palustris CGA009) MAVKLASRRGGDDDMVEAHEINVTPFIDVMLVLLIVFMVAAPLATVDVGVDLPASTAAPQ PRPEKPIFVSLKPDLSLALGEEMVPREALTSALDSVTGGNKDERIFLRADKAVSYGDLMA AMNLLRDAGYLKVALVGLDGSAVQP