Protein Info for TX73_010965 in Rhodopseudomonas palustris CGA009

Annotation: tonB-system energizer ExbB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 56 to 75 (20 residues), see Phobius details amino acids 161 to 187 (27 residues), see Phobius details amino acids 203 to 226 (24 residues), see Phobius details TIGR02797: tonB-system energizer ExbB" amino acids 44 to 252 (209 residues), 301.9 bits, see alignment E=1.3e-94 PF01618: MotA_ExbB" amino acids 134 to 234 (101 residues), 105.9 bits, see alignment E=6.7e-35

Best Hits

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 100% identity to rpa:RPA2127)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (265 amino acids)

>TX73_010965 tonB-system energizer ExbB (Rhodopseudomonas palustris CGA009)
MRKPQGAAAGRAGAAIAAVAFIAAALPGDAWAAADLATLPRDLSPWGMFLGADAVVRTVM
VGLALASLAAWTVWLAKSIELRRSVAVAQRGLERLESDVTLQQAAAETADQHDAVAQMIQ
TVDREASLSGGAHDDGFRERVALRLERVEAAEARRAAIGTGLLASIGAVAPFVGLFGTVW
GIMNAFIGISKANTTNLAVVAPGIAEALLATALGLVAAIPAVVIYNHLTRRVTAYRALLG
DASTQLLLMISREATRPAQRARMVR