Protein Info for TX73_010950 in Rhodopseudomonas palustris CGA009

Annotation: TonB-dependent hemoglobin/transferrin/lactoferrin family receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 779 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR01785: TonB-dependent heme/hemoglobin receptor family protein" amino acids 74 to 776 (703 residues), 627.7 bits, see alignment E=2.6e-192 TIGR01786: TonB-dependent hemoglobin/transferrin/lactoferrin receptor family protein" amino acids 75 to 776 (702 residues), 460.3 bits, see alignment E=1.2e-141 PF07715: Plug" amino acids 89 to 196 (108 residues), 82.9 bits, see alignment E=2.3e-27 PF00593: TonB_dep_Rec" amino acids 299 to 734 (436 residues), 136.6 bits, see alignment E=2.4e-43

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to rpa:RPA2124)

Predicted SEED Role

"TonB-dependent hemin , ferrichrome receptor" in subsystem Hemin transport system or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (779 amino acids)

>TX73_010950 TonB-dependent hemoglobin/transferrin/lactoferrin family receptor (Rhodopseudomonas palustris CGA009)
MVGLNSRAYALLLSVSVVALTIAPASAQTATGSSTSSAQTQVKRDRAARGAQPMAPTADP
RNANAQAGSSTQSLDAITVVATKNEEKAIDALAPASAITLQQIQQFPPSRLQDVFVATPG
VSFQDRGDEPSTSINIRGLQDFGRVAVVVDGARQNYQRSGHGAQGSFFLDPELIGGIDVV
RGPSANIYGSGAIGGVVSFRTKDIDDVVRAGERWGVDLSGSYGSNNARGLGSVFGGVRVD
PSVDVFGGAVYRTQGNYKDGAGTEIGNTGNDLAAGLMKFTVRPADGHEVKIGGIFQDFNY
DVGQFNRGPSQQALYQGSSVYSTSLQNYTGTLSWKYSQPDDTWFDWSVNLYGNRTNSDQT
KTYHYSTSGSGYCGAGNYGNNISGCIGDKRGYNLDTVGIDANNTSRFEYGNWRIAVTYGV
DVFNDKVTTWDSRGNSNITTPGGERTVSGGFIQVKNNYAQWLEVIGAARYDHYELNSNSS
TASGSRLSPKVTLGLTPIAGFTPYVAYAEGYRAPSITETLIAGAHATGGGPALFTCADGT
SGLFCLIPNTALRPEVGKNKEVGINLKYNDVFISGDSFRGKINAFRNDVDNYIELLGSTP
QAYRTVFMGFPVSGVASKYYQYQNIPHARIEGVEVETSYDAGMWFVGVNAAVIRGTNPDT
GLGLVSVPARKVVTTGGLRLLDRQLTIAAQWASYAANTNLPTGYLPGTSYDLVNLNIAYR
PTADVTLNFSIDNLLNNYYRPYAIPGSSSDGTTQNDILWTSPGPGVVYKGGIKVHFGGA