Protein Info for TX73_010835 in Rhodopseudomonas palustris CGA009

Annotation: DoxX family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 141 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 82 to 105 (24 residues), see Phobius details amino acids 112 to 133 (22 residues), see Phobius details PF07681: DoxX" amino acids 20 to 100 (81 residues), 53.7 bits, see alignment E=1.4e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA2102)

Predicted SEED Role

"FIG027115: Membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (141 amino acids)

>TX73_010835 DoxX family protein (Rhodopseudomonas palustris CGA009)
MRSAGEPRWVVPILASPLLWHAARFALVSAYLLGGVVKLFDFAAAVAEQERFGLHPGWLW
ATLAIVVELGGSLLVLADRLVWLGAGALGVLTFVAMLTANAFWSAPAADRWIQANAFFEH
FGLIAGFVLLAMLSDQRRSTS