Protein Info for TX73_010805 in Rhodopseudomonas palustris CGA009

Annotation: precorrin-6A synthase (deacetylating)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 TIGR02434: precorrin-6A synthase (deacetylating)" amino acids 2 to 249 (248 residues), 383.1 bits, see alignment E=3e-119 PF00590: TP_methylase" amino acids 3 to 224 (222 residues), 135.9 bits, see alignment E=9.8e-44

Best Hits

Swiss-Prot: 49% identical to COBF_SINSX: Precorrin-6A synthase [deacetylating] (cobF) from Sinorhizobium sp.

KEGG orthology group: K02228, precorrin-6A synthase [EC: 2.1.1.152] (inferred from 100% identity to rpa:RPA2097)

MetaCyc: 49% identical to precorrin-5 (C1)-methyltransferase (Pseudomonas denitrificans (nom. rej.))
Precorrin-6A synthase (deacetylating). [EC: 2.1.1.152]

Predicted SEED Role

"Precorrin-6A synthase (EC 2.1.1.152)" in subsystem Coenzyme B12 biosynthesis (EC 2.1.1.152)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.152

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>TX73_010805 precorrin-6A synthase (deacetylating) (Rhodopseudomonas palustris CGA009)
MRKILLIGIGPGGPNYLTFQAVEALNRATVFFIPDKGDEKAELRLAREQICERFITAPGY
RFVTIDIPKREAQPQDYRATVDDWHARIADRFAQAMTEQLPEGSCGAFLVWGDPSLYDST
IRILDRLRLRGMEIDYEIIPGITAVQALTARHGIALNGIGEPVTVTTGRKLAATGRWSGE
TMVVMLDGEETFAKIDAEGAEIFWAANLGMDDEVLVTGKLPEIAPEIQRIRRQVRAAKGW
VMDIYLLRKAEDTP