Protein Info for TX73_010580 in Rhodopseudomonas palustris CGA009

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13420: Acetyltransf_4
  • amino acids 42 to 165 (124 residues), 35.7 bits, E=1.8e-12
• PF00583: Acetyltransf_1
  • amino acids 44 to 144 (101 residues), 56.5 bits, E=6.6e-19
• PF13673: Acetyltransf_10
  • amino acids 51 to 149 (99 residues), 33.6 bits, E=7.3e-12
• PF13508: Acetyltransf_7
  • amino acids 61 to 145 (85 residues), 38.7 bits, E=2.1e-13

Best Hits

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 98% identity to rpt:Rpal_2342)

Predicted SEED Role

"GCN5-related N-acetyltransferase"

MetaCyc Pathways

• phosalacine biosynthesis (4/25 steps found)
• phosphinothricin tripeptide biosynthesis (4/25 steps found)

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.183

Use Curated BLAST to search for 2.3.1.183

Protein Sequence (180 amino acids)

>TX73_010580 GNAT family N-acetyltransferase (Rhodopseudomonas palustris CGA009)
MDAASPILIRSSHDGDVEAMLDIYRYYIRRGLDEGIDDHGTPQPDDLKERRKNLRNRRFP
HLVAIRGETVIGYAYVVLFRKRPAYRYTVKHSIYVHPDHLGSGIGRLLMHELIDACAAAG
FRQMIGYIDADNAASLGLHHSFGFATVGRLPGVAYRYGRWADTVMVQRSLGAGATTPPVV