Protein Info for TX73_010560 in Rhodopseudomonas palustris CGA009

Annotation: TRAP transporter large permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 signal peptide" amino acids 1 to 8 (8 residues), see Phobius details transmembrane" amino acids 9 to 32 (24 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 112 to 128 (17 residues), see Phobius details amino acids 139 to 162 (24 residues), see Phobius details amino acids 182 to 205 (24 residues), see Phobius details amino acids 228 to 248 (21 residues), see Phobius details amino acids 254 to 270 (17 residues), see Phobius details amino acids 282 to 306 (25 residues), see Phobius details amino acids 322 to 341 (20 residues), see Phobius details amino acids 349 to 370 (22 residues), see Phobius details amino acids 372 to 377 (6 residues), see Phobius details amino acids 409 to 434 (26 residues), see Phobius details PF06808: DctM" amino acids 7 to 430 (424 residues), 438.1 bits, see alignment E=1.6e-135 TIGR00786: TRAP transporter, DctM subunit" amino acids 17 to 435 (419 residues), 518.8 bits, see alignment E=4.3e-160

Best Hits

Swiss-Prot: 78% identical to DCTM_RHOCA: C4-dicarboxylate TRAP transporter large permease protein DctM (dctM) from Rhodobacter capsulatus

KEGG orthology group: K11690, C4-dicarboxylate transporter, DctM subunit (inferred from 100% identity to rpa:RPA2049)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (441 amino acids)

>TX73_010560 TRAP transporter large permease subunit (Rhodopseudomonas palustris CGA009)
MNTAIIFGLLIALMLTGMPISIALGLTVLSFVVLMTNVPMEAVSLKLFTGIENFEIMAIP
FFILAGNFLTHGGVARRMINFATTMVGHWYGGLGLAGVMACALFAAVSGSSPATVIAIGS
IMLPAMVKQGFPKRFGAGVITTSGALGILIPPSIVMVVYAVATGGSIALDPDGNRVSSAS
VGQLFMAGVIPGIMLASLLGLTTFYRAWKNDYPRLPKASWAERFDAFRKCIWGLLLIVIV
LGGIYAGMFTPTEAAAISAVYAFIIAVFVYRDMGLRDVPRVLLGSANMSAMILYIITNAV
LFSFLMANENIPQQIASWMSTAGVNWVWFLLVVNILLLLAGNVMEATSIVLIMAPILFPV
AVKLGIHPVHLGILMVVNMEVGMCHPPVGLNLYVASGIAKMGITELTVAVMPWLLTMLAF
LALVTYVPEISLWLPRMLGML