Protein Info for TX73_010335 in Rhodopseudomonas palustris CGA009

Annotation: ABC transporter ATP-binding protein/permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 651 transmembrane" amino acids 50 to 71 (22 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 173 to 197 (25 residues), see Phobius details amino acids 203 to 222 (20 residues), see Phobius details amino acids 278 to 303 (26 residues), see Phobius details amino acids 321 to 339 (19 residues), see Phobius details PF00664: ABC_membrane" amino acids 53 to 334 (282 residues), 114.9 bits, see alignment E=5.6e-37 PF00005: ABC_tran" amino acids 396 to 545 (150 residues), 116.3 bits, see alignment E=1.7e-37

Best Hits

Swiss-Prot: 49% identical to AB25B_ARATH: ABC transporter B family member 25, mitochondrial (ABCB25) from Arabidopsis thaliana

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to rpa:RPA2005)

Predicted SEED Role

"ABC transporter HlyB/MsbA family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (651 amino acids)

>TX73_010335 ABC transporter ATP-binding protein/permease (Rhodopseudomonas palustris CGA009)
MAHPHSHSSSGSPVAIPEDKIAQKATLGGTLMHLWPYIWPGDRSDLKMRVVWAIVLLIAA
KAATLIVPFTFKWATDALTGADTAPIEPSNWTLWLIASPLALTASYGLVRALMAVLTQWR
DGIFAKVAMHAVRKLAYRTFVHMHDLSLRFHLERKTGGLTRVLERGRLGIEVIVRMVILQ
LVPTIIELSLVMAVLLWQFDWRYVAAVMVTVVFYMLYTYKATEWRIGIRRRMNDSDSDAN
QKAIDSLLNYETVKYFGAEEREAKRYDKSMRHYEDASVATYTSLAVLNAGQAVIFTFGLT
ATMLMCASGVRNGTNTVGDFVMINAMMIQLYQPLNFMGMVYREIKQAIIDIEKMFAVLSR
KPEVEDRAGAKPLAVEAGTVRFEDVKFAYDPARPILKGLNFEVPAGKTVAIVGPSGAGKS
TISRLLFRLYDVSGGRILIDGQDIRSVTQTSLRAAIGMVPQDTVLFNDTIRYNIRYGRWD
ATDAEVEEAAKTAQIDAFIKASPKGYDTEVGERGLKLSGGEKQRVAIARTVLKAPPILVL
DEATSALDSHTEHEIQGALERVAQNRTSLVIAHRLSTIVGADEIIVLDQGRIAERGTHSQ
LLAAGGLYASMWNRQREAEEARERLALIGDDDSPVRKPEIDDDLATSAAAE